David Shepherd signed limited edition prints and original paintings for sale online here.

 david shepherd tiger fire print
signed limited edition print



Cornwater Fine Art is the world's leading authority on David Shepherd paintings and limited edition prints.

25 years experience and the largest collection of David Shepherd signed, limited edition prints in the UK!

Studio open 24 hours a day, 7 days a week!
Viewing by appointment only

Telephone:- England 01623 799 309
or mobile 07974 371 255

We will endeavour to better any quote and give you the finest possible service
99.9% of signed, limited editions shown below are in stock, although we usually have only one print of each title
For prices and information please call us 01623 799 309 or email d@art.info
CLICK ON IMAGE FOR DETAILS & TO ENLARGE

Signed, limited edition prints, "Tigers, Lions, Cheetahs, Leopards, Jaguars"

    david shepherd signed limited edition print           signed-print-tigerinthesun           davidshepherd-JustCats-signed-print        tigerfire signed limited edition      davidshepherd-sleepytigers
       Cool Waters                      "Tiger in the sun"                   "Just Cats"                   'Tiger Fire'                 'Sleepy Tigers'

     junglegentleman-davidshepherd              intothesunlight-davidshepherd                burningbright signed limited edition print        davidshepherd-tigersofbandhavgarh        davidshepherd-cheetahfamily
    Jungle Gentleman                     'Into the sunlight                  'Burning Bright'      "The Tigers of Bandhavgarh"  Cheetah Family, Serengeti
       Signed, print                        Signed, print                     Signed, print                   Signed, print            Signed, print
    Limited edition lithograph       Limited edition lithograph      Limited edition lithograph       Limited edition lithograph       Limited edition 

     davidshepherd-indiansiesta               davidshepherd-tigerinthesnow            davidshepherd-whitetigerofrewa         davidshepherd-lonelyvigil      davidshepherd-snowleopard           
      Indian Siesta                         Tiger in the snow               "The White Tiger of Rewa"         Lonely Vigil             Snow Leopard
        Signed, print                          Signed, print               Silkscreen published 2001       David Shepherd  Signed, limited edition print

    davidshepherd-cheetahsilk                davidshepherd-inthecoolofevening              davidshepherd-Leopards         davidshepherd-africasilk         indian summer
         Cheetah                      'In the cool of evening'                  'Leopards'                    "Africa"                  'Indian Summer'
   Silkscreen Published 1992          Silkscreen Published 2002         Silkscreen Published 1997    Silkscreen Published 1993        Silkscreen
   Signed, limited edition print      Signed, limited edition print   Signed, limited edition print  Signed, limited edition print          Lithograph
 
    davidshepherd-firstlightatsavuti                davidshepherd-savutisands           davidshepherd-sentinel         davidshepherd-serengetifriends         davidshepherd-ranthamboretiger
    First light at Savuti                   Savuti Sands                      The Sentinel            "Serengeti friends"           The Ranthambore Tiger    
       Signed, print                        Signed, print                     Signed, print                Signed, print            Giclee edition of 55
    
    davidshepherd-twogentlemenofsavuti               davidshepherd-luangwa               davidshepherd-Jaguar           davidshepherd-jaguars
   Two gentlemen of Savuti               Evening in the Luangwa                   Jaguar                          'Jaguars'
      Signed print                    signed, limited edition                  signed print                signed limited edition print
                               
     davidshepherd-cheetahs                cheetahs of Namibia               davidshepherd-cloudedleopardandcubs            davidshepherd-bestspotsonhill
         "Cheetahs"                        Cheetahs of Namibia             Clouded leopard and cubs         Best spots on the hill
        Signed print                      signed, limited edition                  signed print               signed limited edition print
    
      davidshepherd-snowleopardcubcameo                        davidshepherd-ocelotcubcameo                     davidshepherd-tigercubcameo                  davidshepherd-paintingofatiger.jpg               
   Snow leopard cub cameo                Ocelot cub cameo                 Tiger cub cameo                'Working sketch for the          
  Signed, limited edition            signed, limited edition                 Signed, print                      painting of a tiger'


      
     davidshepherd-coolwaters               davidshepherd-teenagetiger                    davidshepherd-cooltiger                   davidshepherd-bengaltiger 
     Cool Waters                          Teenage Tiger                         Cool Tiger                    Bengal Tiger cameo
     Signed print                      signed, limited edition                 signed print              signed limited edition print

     davidshepherd-lioncubs                     davidshepherd-tigercubs               davidshepherd-tigersketch1986                   davidshepherd-lionsketch1986
         Lion cubs                            Tigercubs                       Tiger sketch                       Lion sketch
        Signed print                    signed, limited edition               signed print                   signed limited edition print
   

       davidshepherd-lionhead                       davidshepherd-tigerhead                   davidshepherd-lioncameo                   davidshepherd-youngafrica 
        Lion head                             Tiger head                        Lion cameo                        Young Africa
  David Shepherd                Signed, print                        Signed, print                      Signed, print
    
      
  
Signed, limited edition prints, Elephants
     
     davidshepherd-happytime            davidshepherd-inthemasaimara            davidshepherd-gentlegiant            davidshepherd-oldgeorge
       Happy Time                       In the Masai Mara                     Gentle Giant                     Old George under
       Signed, print                      Giclee edition of 295              Signed, print              his favourite Baobab tree
                                                                                                  

     davidshepherd-oldcharlie                 davidshepherd-elephantandanthill             davidshepherd-eveningoftheelephant             davidshepherd-dustyevening    
   Old Charlie                The Elephant and the Anthill        Evening of the elephant               Dusty Evening
       lithograph                           lithograph                      by David Shepherd           signed, limited edition
         print                                    print                             print                         Silkscreen  

   
       davidshepherd-mysavutifriend                   davidshepherd-elephantsandegrets               davidshepherd-luangwaevening
     My Savuti Friend                   Elephants and Egrets                   Luangwa Evening
         Silkscreen 2003                      Signed, print                        Signed, print

                             davidshepherd-tembomzee               davidshepherd-crossing                davidshepherd-eveninginafrica                                  
       'Tembo Mzee'                        'The Crossing'                     Evening in Africa
     Signed, print                          Signed, print                       Signed, print
     

        davidshepherd-amboseli               davidshepherd-threehappyjumbos             davidshepherd-elephantheaven        
 'Amboseli'silkscreen                'Three Happy Jumbos'                   Elephant Heaven 
  Signed, print                          Signed, print                          Signed, print

        davidshepherd-africanbabies                  davidshepherd-baobabandfriends                 davidshepherd-landofthebaobabtrees             
     African Babies                      Baobab and friends                Land of the Baobab tree       
Signed, print                         Signed, print                        Signed, print

   davidshepherd-africanwaterhole                   davidshepherd-mothersmeeting               davidshepherd-africanlandscape        
African Waterhole                         Mothers Meeting                  African Landscape
Signed, print                         Signed, print                      Signed, print
Signed, limited edition prints, Wildlife of the world
   davidshepherd pandas pencil                     davidshepherd-cheetahsketch                 davidshepherd-elephantssketch               davidshepherd-tigersketch
      Panda sketch                 Cheetah, pencil drawing            Elephants, pencil drawing           Tigers, pencil drawing
        Signed, print                     Signed, print                    Signed, print               Signed limited edition print
  
       davidshepherd-winterinwolong              davidshepherd-pandasofwolong             davidshepherd-upagumtree            davidshepherd-koala
'Winter in Wolong'                Pandas of Wolong                 Up a Gum Tree              "Koala"
         Signed, print           Signed, limited edition print             Signed, print       Signed limited edition print
                                                

    davidshepherd-waterholetrilogy               davidshepherd-highandmighty                  davidshepherd-masaigiraffeandyoung
  The Water-hole Trilogy                   High and Mighty                 Masai Giraffe and young
       Signed, print                          Signed, print                    Signed, print

                        davidshepherd-zebramother                     davidshepherd-zebrasandcolonyweavers                 davidshepherd-aftertherain                      
Zebra, mother and foal, Etosha      'Zebras and Colony weavers'             After the rain
       Signed, print                        Signed, print                       Signed, print
  
    
       davidshepherd-egretsandfriends               davidshepherd-hotsprings              davidshepherd-warthog
                      Egrets and Friends                     American Bison               The Warthog Family               
        Signed, print                        Signed, print                       Signed, print

                      davidshepherd-africanafternoon               davidshepherd-IntheThickStuff              davidshepherd-arabianoryx         davidshepherd-greaterkudu                                            
    African Afternoon                   "In the thick stuff"                 Arabian Oryx                Greater Kudu
          Signed, print                  Signed, print                  Signed, print            Signed limited edition print

     davidshepherd-polarbearcountry                 davidshepherd-lonelyvigil             davidshepherd-lonewanderersofthearctic
      Polar Bear Country                     Lonely Vigil                Lone Wanderers of the Arctic
        Signed, print                           Signed, print                  Signed, print

     davidshepherd arcticfoxes                 davidshepherd-mountainlion               davidshepherd-icewilderness
      Arctic Foxes                      Mountain Lion silkscreen                 Ice Wilderness              
     Signed, print                             Signed, print                Signed limited edition print

  

    davidshepherd-Orang-davidshepherd                 davidshepherd-lowlandgorillas               davidshepherd-mountaingorillasofrwanda         davidshepherd-inthemistsofrwanda
  Men of the Woods, Orang-Utans    Lowland Gorillas (silkscreen)       Mountain gorillas of Rwanda      In the mists of Rwanda
   Image size 17" x 27"                  Image size 14" x 21"               Image size 27" x 18"        Silkscreen published 2004
   
     davidshepherd-hotpotami                 davidshepherd-sundaybest                   davidshepherd-HappyHippo                  davidshepherd-babygorilla
      Hot Potami                        Sunday Best                          Happy Hippo                    Baby Gorilla
   Signed, print                         Signed, print                          Signed, print       signed, limited edition print
   

    davidshepherd-rhinoreverie                    davidshepherd-indianrhino                   davidshepherd-rhinobeware           davidshepherd-black-rhino
    Rhino Reverie                        Indian Rhino                          Rhino Beware               Black Rhino cameo
   Signed, print                         Signed, print                          Signed, print        signed, limited edition print
 
Signed, limited edition prints, British wildlife and landscapes
       davidshepherd-whisky                   davidshepherd-countrycousins                     davidshepherd-highlandcattle          davidshepherd-fredafterhisshampoo
  Whisky the farmyard cat                Country cousins                      Highland Cattle          Fred after his Shampoo
        by Shepherd                   signed limited edition print                by Shepherd         Signed, limited edition print

    
     davidshepherd-muscovyducks                    davidshepherd-lifegoeson                 davidshepherd-roosters              davidshepherd-eggssixpenceadozen
     Muscovy Ducks                     Life goes on Sept.'40                  Roosters                    Eggs sixpence a dozen
Signed, limited edition print      Signed, limited edition print     Signed, limited edition print     Signed, limited edition print
 
    davidshepherd-whilethesunshines                   davidshepherd-lunchbreak               davidshepherd-thisengland            davidshepherd-mrspandthekids
    While the sun shines                  The Lunchbreak                        This England                Mrs P and the kids
      Signed, print                       Signed, print                        Signed, print         signed, limited edition print
   

    davidshepherd-oldbens                    davidshepherd-lastleavesofautumn                   davidshepherd-LastLoadofSummer            davidshepherd-orphans
    Old Ben's cottage               'Last leaves of Autumn'                The last load of summer             The Orphans
                                                         Published 1987               Signed,limited edition of 850     Signed, limited edition

    davidshepherd-grannie'skitchen             davidshepherd-grandpasworkshop                 davidshepherd-Clockmender'sCat            davidshepherd-playtime
    Grannie's Kitchen                Grandpa's Workshop                    The Clockmender's Cat                 Playtime
      Signed print                    signed, limited edition                   signed print            signed limited edition print
   

    davidshepherd-isitaladybird                     davidshepherd-teddy                  davidshepherd-biscuits              davidshepherd-cottagecompanions            
    Is it a Ladybird?           'But teddy doesn't need a ticket'               Biscuits                    'Cottage companions'         
Signed, limited edition print    Signed, limited edition print      Signed, limited edition print    Signed, limited edition print

       davidshepherd-happyhomefordonkeys                    davidshepherd-donkeys                  davidshepherd-donkeytalk                davidshepherd-winterfoxes-davidshepherd
  Happy home for Donkeys                   Donkeys                            Donkeytalk                         Winter Foxes
Signed, limited edition print     Signed, limited edition print         Signed, limited edition print   Signed, limited edition print


    davidshepherd-ploughteam                    davidshepherd-summertime                  davidshepherd-captainandsergeant                davidshepherd-porkers
       Plough Team                         Summertime                      Captain and Sergeant                 "Porkers"
    Signed, print                         Signed, print                       Signed, print           signed, limited edition print
    
     davidshepherd-shampootime           davidshepherd-oldforge                davidshepherd-jimmysforges                davidshepherd-spring ploughing
      Shampoo Time                    'The Old Forge'                     Jimmy's Forge                     "Spring Ploughing"
  Signed, limited edition print  Signed, limited edition print       Signed, limited edition print     Signed, limited edition print


     shelties-davidshepherd                 davidshepherd-highnoon                   davidshepherd-shoeingtime                  davidshepherd-lazyhazydays
       'Shelties'                          High Noon                        'Shoeing Time'                        Lazy hazy days
      Signed, print                     Signed, print                           Signed, print           signed, limited edition print
         
     davidshepherd-hedgehog                      davidshepherd-harvestmouse                       davidshepherd-watervole                   davidshepherd-foal
      'Baby Hedgehog'                  'Harvest Mouse'                       The Water Vole                  "When I grow up...
         Signed, print                    Signed, print                     Signed, print         signed, limited edition print
       
      baby tawny            davidshepherd-Nuts            davidshepherd-ziggy            davidshepherd-haggis       davidshepherd-muffin
  'Baby Tawny Owl'              'Nuts'               "Ziggy"                  "Haggis of Battersea"        "Muffin"
         Signed, print       Signed, print         Signed, print     signed, limited edition print  signed, limited edition print

    davidshepherd-highlandcattle             davidshepherd-Prince                   signed limited edition print highlandmist                badgers
        Highland Cattle                 Prince of Rannoch Moor                  Highland Mist                        "Badgers"            
       Signed, print                     Signed, print                        Signed, print             signed, limited edition print

  
      
Signed, limited edition prints, Aviation
                davidshepherd-winterof43               davidshepherd-lifegoeson                immortal hero                  
 Winter of '43              'Life goes on, Sept1940'                "Immortal Hero"  
       Signed, print                    Signed, print              signed, limited edition print
Signed, limited edition prints, Steam Trains
               scotsman34-davidshepherd               heavyfreight-davidshepherd                print on shed                
 Scotsman '34                      Heavy Freight '67                     "On Shed" 
Signed, limited edition print        Signed, limited edition print      Signed, limited edition print 

   
    davidshepherd-blackfive               davidshepherd-giantsatrest                wilesden shed
   Black Five Country                   Giants at rest                          Wilsden Shed
      signed print              signed, limited edition print       signed, limited edition print
    
                 davidshepherd-zambezisawmill              davidshepherd-onthesubnigelmine                davidshepherd-guildfordsteamsheds                
Zambezi sawmills railway            On the sub nigel mine                 Guildford steam sheds
   Signed, print                             Shepherd                     set of 3 signed,
         limited edition                     Signed, print                      limited edition prints    
Signed, limited edition prints, Military
     davidshepherd-alamein             davidshepherd-ark                davidshepherd-Glory               davidshepherd-checkpointatforkhill
            'Alamein'              'The Ark turning into wind'                'Glory Days'                 Check point at Fork Hill
            Signed, print                  Signed, print                       Signed, print                signed, limited edition print
All prices are inclusive;( post and packing is charged at cost) visa All major credit/debit cards accepted

EMAIL:- administrator@davidshepherd.com
Telephone England 01623 799 309
or mobile 07974 371 255




David Shepherd, CBE, FRSA, FRGS, OBE.
Known internationally as one of the world's leading wildlife artists,
and also a passionate conservationist and he freely admits that he owes much success to the animals he paints.
Prolific in output as a painter with a brimful of stories and anecdotes, he is an extrovert who enjoys talking,
and enjoys being known as a natural promoter and an ardent ambassador for conservation; it's the way he is.

Explaining that he became an artist in childhood because he couldn't do anything else.
"My life was a total disaster until I was 20 years old. My one and only ambition was to be a gamewarden, so when I'd finished my education,
I went rushing out to Kenya with the incredibly arrogant idea that I was God's gift to the National Parks. It was a disaster. I knocked on the door of the
Head Gamewarden in Nairobi and said, 'I'm here, can I be a game warden?' I was told I wasn't wanted.
My life was in ruins; that was the end of my career in three seconds flat."
"Up to that point, my only interest in art had been as an escape from the rugger field. The game was compulsory at school and I was terrified of it.
I couldn't see any fun in being buried under heaps of bodies in the mud and having my face kicked in. I fled into the art department where it was more
comfortable and painted the most unspeakably awful painting of birds."

Deflated and homesick, he took a job as a receptionist in a hotel on the Kenya coast; the salary was one pound a week.
"So there I was at Malindi on the Kenya Coast in this hotel. I painted some more bird paintings on plasterboard, and I sold seven of them for £10 each to the
culture-starved inhabitants of the town and paid my passage home to England on a Union Castle steamer."
Arriving home, penniless, he had two choices,Mr Shepherd decided he could either become an artist or a bus driver.
Since he suspected that most artists starved in garrets, life as a bus driver seemed the safer bet.

"But my dad was marvellous and said that if I really wanted to be an artist, I'd better get some training.
The only school we knew anything about was The Slade School of Fine Art in London, so I sent them my first bird painting."
The Slade, too, turned him down. He had no talent, they said, and he wasn't worth teaching.
The bus driver position was looking more likely all the time, except for a 'chance meeting that changed my life'.
At a London cocktail party, the young artist was introduced to Robin Goodwin.
Robin was a professional painter who specialised in portraits and marine subjects. (considered to have been one
of the finest marine painters of this century). He didn't and wouldn't take students, Robin told him, but he agreed to have a look at the work.

"The next day, I trotted up to the studio in Chelsea and a miracle happened. I showed him that very first bird picture, which I still have and,
for reasons that I have never been able to understand, he decided to take me on. I owe all my success to that man.
He is responsible for my being where I am today."

the man who loves giants
'The Man who loves giants.'
In 1976, his autobiography, 'The Man Who Loves Giants', was published and rapidly became a best seller.
He revised and updated it in 1989. 'A Brush with Steam' was published in 1984 and in October 1985,
The Man and His Paintings' was published, which, for the first time, brought together
in a single volume a fully representative selection of his work. In 1992, 'An Artist in Conservation' was published,
which is a stunning collection of the best of his wildlife art with over 90 colour plates.

In October, 1995 , 'My Painting Life' and 'Only One World' were published and in 2004 his latest book,
'Painting with David Shepherd, His Unique Studio Secrets Revealed' was published.

TV Documentaries

lunchbreak painting 'TheLunchbreak.'
In 1972 the BBC produced his life story 'The Man Who Loves Giants', a 50-minute documentary film, narrated
by his friend, the late James Stewart, and which has been shown all over the world.

Other documentaries for television have also been made, including 'Last Train to Mulobezi'; this film tells
the epic story of the rescue from the Zambezi Sawmills Railway
in Zambia of an ancient locomotive and railway coach and their 12,000 mile journey back to Britain.
These were presented as a gift by His Excellency, Dr Kenneth Kaunda, the then President of Zambia,
after raising funds with other artists, (through an auction of seven paintings in the USA).
This enabled him to buy a helicopter, which he presented to the Government of Zambia for anti-poaching work.

In 1988 he made the series 'In Search of Wildlife' with Thames TV; a series of six half-hour films, featuring endangered mammals throughout the world.
These have subsequently been shown in the United States of America on the Public Broadcasting Channel. Also in 1990 he made the first programme
in the annual series of 'Naturewatch' with Julian Pettifer; and has been the 'target' for 'This is Your Life'.

Awards

1971
Honorary Degree in Fine Arts by the Pratt Institute in New York.
1973
The Order of the Golden Ark by HRH The Prince of The Netherlands for his services to conservation.
1979
Member of Honour of the World Wide Fund for Nature
The Order of the British Empire for his services to wildlife conservation.
1986
Fellow of the Royal Society of Arts.
1988
President Kenneth Kaunda of Zambia awarded him with the Order of Distinguished Service.
He was made a Fellow of the Royal Geographical Society
Honorary Doctorate of Science of Hatfield Polytechnic (now the University of Hertfordshire) in 1990.
1996
Officer (Brother) of the Order of St. John.
2004
Granted the Freedom of the City of London.
2008
Awarded a C.B.E. for services to charity and wildlife
David today
"An artist who seems to stride across continents". In today's scheme of things, he is a larger-than-life figure
who is regarded by many people as being the world's leading wildlife painter. His signed, limited edition prints can be seen in many homes
throughout the world and he lives life at a dizzying pace, enjoying it to the fullest.

"I want to live to be 150. It will take that long to do everything I want to do. Unlike some people who perhaps lead a humdrum existence,
I run almost everywhere I go because I am so anxious to get on with the joy of what I am doing next."

Mr Shepherd celebrated his 70th birthday on 25th April 2001 with a fundraising dinner at the Natural History Museum
which raised over £100,000 for DSWF's wildlife projects.

David now lives with his wife Avril in West Sussex and his four daughters all share his passion for conservation and are involved in the work of DSWF.

If you would like to visit the studio in Nottinghamshire, (Saturdays and Sundays are fine too) Please call 01623 799 309
We have a collection of over 500 David Shepherd signed limited edition prints and original paintings for sale.
A viewing can also be arranged at your home.

The Ten Four Web DirectoryAbiz Web Directory © S & W signed, limited edition print publishers © David Shepherd artist
Swaziland freedom village malls Minerals This site is listed under By Artist Directory Internet Website Directory At Skynet Technologies, we are offering effective and affordable website designing and promotion services to give your online presence a better and brighter look also provide Domain Registration, Web Hosting, Website Designing, Web Development, E-Commerce Development, Web Promotion
David Shepherd xml sitemap David Shepherd html sitemap David Shepherd URL list